Cat. #153803
Human Erythropoietin beta (EpoB), Recombinant Protein
Cat. #: 153803
Sub-type: Cytokine
Availability: 3-4 weeks
This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.
Contributor
Inventor: Natasa Skoko
Institute: International Centre For Genetic Engineering And Biotechnology (ICGEB)
Tool Details
*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)
- Tool name: Human Erythropoietin beta (EpoB), Recombinant Protein
- Alternate name: Epoetin, Erythropoietin, EP
- Research fields: Stem cell biology
- Tool sub type: Cytokine
- Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD
- Cellular tissue localisation: Hematopoietic Stem and Progenitor Cells, Mesoderm, PSC-Derived, Pluripotent Stem Cells
- Source: Pichia pastoris
- Description: Erythropoietin (EPO) is a glycoprotein growth factor that is produced primarily in the kidney in response to hypoxia or anemia. It is the principal physiological regulator of erythropoiesis. EPO promotes erythropoiesis by binding to a homodimeric cell surface receptor that activates JAK2/STAT5, PI3K/AKT, and MAPK pathways, and stimulates the proliferation and differentiation of erythroid progenitor cells.
- Molecular weight: 18.4 kDa
- Expression system: Recombinant
- Uniprot id: P01588
Handling
- Storage conditions: -20° C
- Shipping conditions: Dry Ice
Application Details
- Application notes: Molecular Weight: 18.4 kDa UniProt number P01588
References
- Erythropoietin (EPO) is a glycoprotein growth factor that is produced primarily in the kidney in response to hypoxia or anemia. It is the principal physiological regulator of erythropoiesis. EPO promotes erythropoiesis by binding to a homodimeric cell surface receptor that activates JAK2/STAT5, PI3K/AKT, and MAPK pathways, and stimulates the proliferation and differentiation of erythroid progenitor cells.
