#161712

Recombinant holo-Acyl carrier protein (holo-AcpP) from Escherichia coli

Cat. #161712

Recombinant holo-Acyl carrier protein (holo-AcpP) from Escherichia coli

Cat. #: 161712

Availability: 3-4 weeks

This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.

Contributor

Inventor: Dr. Alistair K. Brown

Institute: The University of Newcastle Upon Tyne

Tool Details
Handling
References

Tool Details

*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)

  • Tool name: Recombinant holo-Acyl carrier protein (holo-AcpP) from Escherichia coli
  • Sequence: MGSSHHHHHHSSGLVPRGSHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLG ADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
  • Source: Escherichia coli
  • Description: Activated recombinant AcpP from Escherichia coli (cleavable tag) expressed in an E.coli BL21(DE3) derivative. N-terminal His6-tagged thrombin cleavable (underlined) AcpP.
  • Molecular weight: Holo-AcpP MW (with His6-tag): 11142.84

Handling

  • Purity: Minimum purity: 90% by LC-MS and SDS-PAGE.

References

  • Marcella et al. 2017. Applied Microbiology Biotechnology. 101(23-24): 8431-8441. PMID: 29075826

Tool enquiry

Please ensure you use your organisation email address rather than personal where possible, as this helps us locate your organisation in our system faster.

Please note we may take up to three days to respond to your enquiry.

CancerTools.org uses the contact information provided to respond to you about our research tools and service. For more information please review our privacy policy.