
Cat. #161712
Recombinant holo-Acyl carrier protein (holo-AcpP) from Escherichia coli
Cat. #: 161712
Availability: 3-4 weeks
This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.
Contributor
Inventor: Dr. Alistair K. Brown
Institute: The University of Newcastle Upon Tyne
Tool Details
*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)
- Tool name: Recombinant holo-Acyl carrier protein (holo-AcpP) from Escherichia coli
- Sequence: MGSSHHHHHHSSGLVPRGSHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLG ADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
- Source: Escherichia coli
- Description: Activated recombinant AcpP from Escherichia coli (cleavable tag) expressed in an E.coli BL21(DE3) derivative. N-terminal His6-tagged thrombin cleavable (underlined) AcpP.
- Molecular weight: Holo-AcpP MW (with His6-tag): 11142.84
Handling
- Purity: Minimum purity: 90% by LC-MS and SDS-PAGE.
References
- Marcella et al. 2017. Applied Microbiology Biotechnology. 101(23-24): 8431-8441. PMID: 29075826


