Human Interferon alpha 2A

Tool Details

*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)

• Tool name: Human Interferon alpha 2A
• Alternate name: Human IFN alpha 2A, IFN-alpha 2, IFNA2, IFNA2a
• Research fields: Cancer;Immunology
• Tool sub type: Cytokine
• Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
• Cellular tissue localisation: B cells, Cancer cells, NK cells, T cells
• Source: E.coli
• Description: Interferon-alpha (IFN-a) is a type I interferon, produced by virus-infected cells, and is released as a soluble factor to initiate antiviral responses. IFN-a2 is the most potent IFN-a used in fundamental research and in most clinical applications. The best-known IFN-a2 subvariants, 2A and 2B, differ by only one or two amino acids at positions 23 and/or 34 of the mature protein. Type I IFNs exert potent antitumor activity by increasing the cytotoxic activity of NK and T cells, as well as by inhibiting the proliferation of cancer cells. Additionally, it has been shown that proinflammatory IFN-a modulates the function of B cells in patients with systemic lupus erythematosus, and pegylated forms of IFN-alpha 2A and 2B have implications in the treatment of hepatitis C.
• Molecular weight: 19.4 kDa
• Uniprot id: P01563
• Additional notes: Lys at position 23

Handling

• Storage conditions: -20° C
• Shipping conditions: Dry Ice

Application Details

• Application notes: Molecular Weight: 19.4 kDa UniProt number P01563 (Lys at position 23)