#153802

Human Erythropoietin alpha (EpoA), Recombinant Protein

Cat. #153802

Human Erythropoietin alpha (EpoA), Recombinant Protein

Cat. #: 153802

Sub-type: Cytokine

Availability: 3-4 weeks

This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.

Contributor

Inventor: Natasa Skoko

Institute: International Centre For Genetic Engineering And Biotechnology (ICGEB)

Tool Details
Handling
Application Details

Tool Details

*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)

  • Tool name: Human Erythropoietin alpha (EpoA), Recombinant Protein
  • Alternate name: Epoetin, Erythropoietin, EP
  • Research fields: Stem cell biology
  • Tool sub type: Cytokine
  • Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD
  • Cellular tissue localisation: Hematopoietic stem and Progenitor cells, Mesoderm, PSC-Derived, Pluripotent stem cells
  • Source: Chinese Hamster Ovary Cells
  • Description: Erythropoietin (EPO) is a glycoprotein growth factor that is produced primarily in the kidney in response to hypoxia or anemia. It is the principal physiological regulator of erythropoiesis. EPO promotes erythropoiesis by binding to a homodimeric cell surface receptor that activates JAK2/STAT5, PI3K/AKT, and MAPK pathways, and stimulates the proliferation and differentiation of erythroid progenitor cells.
  • Molecular weight: 18.4 kDa
  • Expression system: Recombinant
  • Uniprot id: P01588

Handling

  • Storage conditions: -20° C
  • Shipping conditions: Dry Ice

Application Details

  • Application notes: Molecular Weight: 18.4 kDa UniProt number P01588