#161712

Recombinant holo-Acyl carrier protein (holo-AcpP) from Escherichia coli

Please Enter Your Email ID
Email ID

Cat. #161712

Recombinant holo-Acyl carrier protein (holo-AcpP) from Escherichia coli

Cat. #: 161712

This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.

Contributor

Inventor: Dr. Alistair K. Brown

Institute: The University of Newcastle Upon Tyne

Tool Details
Handling
References

Tool Details

*FOR RESEARCH USE ONLY

  • Tool name: Recombinant holo-Acyl carrier protein (holo-AcpP) from Escherichia coli
  • Sequence: MGSSHHHHHHSSGLVPRGSHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLG ADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
  • Source: Escherichia coli
  • Description: Activated recombinant AcpP from Escherichia coli (cleavable tag) expressed in an E.coli BL21(DE3) derivative. N-terminal His6-tagged thrombin cleavable (underlined) AcpP.
  • Molecular weight: Holo-AcpP MW (with His6-tag): 11142.84

Handling

  • Purity: Minimum purity: 90% by LC-MS and SDS-PAGE.

References

  • Marcella et al. 2017. Applied Microbiology Biotechnology. 101(23-24): 8431-8441. PMID: 29075826