#153651

Anti-Growth Differentiation Factor 9 [53/1]

Please Enter Your Email ID
Email ID

Cat. #153651

Anti-Growth Differentiation Factor 9 [53/1]

Cat. #: 153651

Sub-type: Primary antibody

Unit size: 100 ug

Target: Growth Differentiation Factor 9

Class: Monoclonal

Application: ELISA ; IHC ; WB

Reactivity: Human

Host: Mouse

£300.00

This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.

Contributor

Institute: BioServ UK Ltd

Tool Details
Target Details
Applications
Handling
References

Tool Details

*FOR RESEARCH USE ONLY

  • Name: Anti-Growth Differentiation Factor 9 [53/1]
  • Alternate name: Growth/differentiation factor 9, GDF-9, GDF9
  • Research fields: Cell signaling and signal transduction
  • Clone: 53/1
  • Tool sub type: Primary antibody
  • Class: Monoclonal
  • Conjugation: Unconjugated
  • Molecular weight: 17.5 kDa
  • Strain: Balb/c
  • Reactivity: Human
  • Host: Mouse
  • Application: ELISA ; IHC ; WB
  • Description: GDF9 is plays a vital role in ovarian folliculogenesis, follicle development and fertility. Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
  • Immunogen: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
  • Isotype: IgG1
  • Myeloma used: Sp2/0-Ag14
  • Recommended controls: Ovary

Target Details

  • Target: Growth Differentiation Factor 9
  • Molecular weight: 17.5 kDa
  • Tissue cell line specificity: Ovary
  • Target background: GDF9 is plays a vital role in ovarian folliculogenesis, follicle development and fertility. Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

Applications

  • Application: ELISA ; IHC ; WB

Handling

  • Format: Liquid
  • Unit size: 100 ug
  • Shipping conditions: Shipping at 4° C

References

  • Li et al. 2015. Mol Endocrinol. 29(1):40-52. PMID: 25394262.
  • Modifications of human growth differentiation factor 9 to improve the generation of embryos from low competence oocytes.
  • Simpson et al. 2014. J Clin Endocrinol Metab. 99(4):E615-24. PMID: 24438375.
  • Aberrant GDF9 expression and activation are associated with common human ovarian disorders.
  • Simpson et al. 2012. Endocrinology. 153(3):1301-10. PMID: 22234469.
  • Activation of latent human GDF9 by a single residue change (Gly 391 Arg) in the mature domain.
  • Mottershead et al. 2008. Mol Cell Endocrinol. 283(1-2):58-67. PMID: 18162287.
  • Characterization of recombinant human growth differentiation factor-9 signaling in ovarian granulosa cells.
  • Gilchrist et al. 2004. Biol Reprod. 71(3):732-9. PMID: 15128595.
  • Immunoneutralization of growth differentiation factor 9 reveals it partially accounts for mouse oocyte mitogenic activity.