Anti-Growth Differentiation Factor 9 [53/1]

Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

Contributors

Institute
BioServ UK Ltd
Cat. #: 153651
Tool sub type: Primary antibody
Unit size: 100 ug
Research Fields: Cell signaling and signal transduction
Application: ELISA ; IHC ; WB
Target: Growth Differentiation Factor 9
Reactivity: Human
Clone: 53/1
Host: Mouse
Class: Monoclonal
Alternate name: Growth/differentiation factor 9, GDF-9, GDF9
Product description: GDF9 is plays a vital role in ovarian folliculogenesis, follicle development and fertility. Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
Conjugation: Unconjugated
Isotype: IgG1
Molecular weight: 17.5 kDa
Immunogen: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
Myeloma used: Sp2/0-Ag14
Target background: GDF9 is plays a vital role in ovarian folliculogenesis, follicle development and fertility. Clone 53/1 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
Format: Liquid
Shipping conditions: Dry ice
References:

Li et al. 2015. Mol Endocrinol. 29(1):40-52. PMID: 25394262.

Modifications of human growth differentiation factor 9 to improve the generation of embryos from low competence oocytes.

Simpson et al. 2014. J Clin Endocrinol Metab. 99(4):E615-24. PMID: 24438375.

Aberrant GDF9 expression and activation are associated with common human ovarian disorders.

Simpson et al. 2012. Endocrinology. 153(3):1301-10. PMID: 22234469.

Activation of latent human GDF9 by a single residue change (Gly 391 Arg) in the mature domain.

Mottershead et al. 2008. Mol Cell Endocrinol. 283(1-2):58-67. PMID: 18162287.

Characterization of recombinant human growth differentiation factor-9 signaling in ovarian granulosa cells.

Gilchrist et al. 2004. Biol Reprod. 71(3):732-9. PMID: 15128595.

Immunoneutralization of growth differentiation factor 9 reveals it partially accounts for mouse oocyte mitogenic activity.

Images

View Gallery
Biological neutralizing capacity of 53/1 by ELISA. Biological neutralizing specificity of anti-GDF9-53 with some members of the TGF? superfamily. Mouse MGC were cultured with human TGF?1 (0.5 ng/ml); human activin A (50 ng/ml); or mouse GDF9 (40 ng/ml); either in the absence or presence of a high neutralizing dose of 40 ?g/ml of mAb-GDF9-53 or 40 ?g/ml human IgG. Source

Related Tools for Antibodies

Cat. # Tool Name
151030 Anti-Progesterone [11P14] Key Info View Tool
151021 Anti-CyclinB1 [V152] Key Info View Tool
151034 Anti-HSVUL42 [13D11] Key Info View Tool
151037 Anti-Cdk1 [17 (A17)] Key Info View Tool
151035 Anti-CD8 [14] mAb Key Info View Tool

Tool enquiry

Please ensure you use your organisation email address rather than personal where possible, as this helps us locate your organisation in our system faster.

Please note we may take up to three days to respond to your enquiry.

CancerTools.org uses the contact information provided to respond to you about our research tools and service. For more information please review our privacy policy.