
Cat. #153804
Human Insulin (INS), Recombinant Protein
Cat. #: 153804
Sub-type: Cytokine
Availability: Please enquire for quantities and pricing
This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.
Contributor
Inventor: Natasa Skoko
Institute: International Centre For Genetic Engineering And Biotechnology (ICGEB)
Tool Details
*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)
- Tool name: Human Insulin (INS), Recombinant Protein
- Alternate name: Insulin, INS
- Research fields: Cell signaling and signal transduction;Metabolism
- Tool sub type: Cytokine
- Sequence: B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT A chain: GIVEQCCTSICSLYQLENYCN
- Cellular tissue localisation: Beta cells of Pancreatic Islets
- Source: Pichia pastoris
- Description: Two-chain polypeptide hormone produced by the ß-cells of pancreatic islets. The a and ß chains are joined by two interchain disulfide bonds. The a chain contains an intrachain disulfide bond. Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat. Serum-free medium supplements such as insulin are essential for long-term growth of commonly used mammalian cell lines. When insulin is absent from media, cell may exhibit disturbances in morphology and growth rate.
- Expression system: Recombinant
- Uniprot id: P01308
- Additional notes: Human recombinant insulin is identical in function and structure to the native human sequence. A hormone consisting of two polypeptide chains, Insulin's A-chain (21 amino acids) and B-chain (30 amino acids) are covalently linked by disulfide bonds between cysteine residues. Molecular Weight: ~5.8 kDa UniProt number P01308
Handling
- Storage conditions: -20° C
- Shipping conditions: Dry Ice
Application Details
- Application notes: Human recombinant insulin is identical in function and structure to the native human sequence. A hormone consisting of two polypeptide chains, Insulinâ˛s A-chain (21 amino acids) and B-chain (30 amino acids) are covalently linked by disulfide bonds between cysteine residues. Molecular Weight: ~5.8 kDa UniProt number P01308