#153801

Human Granulocyte Colony-Stimulating Factor (GCSF), Recombinant Protein

Please Enter Your Email ID
Email ID

Cat. #153801

Human Granulocyte Colony-Stimulating Factor (GCSF), Recombinant Protein

Cat. #: 153801

Sub-type: Cytokine

Availability: Please enquire for quantities and pricing

This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.

Contributor

Inventor: Natasa Skoko

Institute: International Centre For Genetic Engineering And Biotechnology (ICGEB)

Tool Details
Handling
Application Details

Tool Details

*FOR RESEARCH USE ONLY

  • Tool name: Human Granulocyte Colony-Stimulating Factor (GCSF), Recombinant Protein
  • Alternate name: Human Granulocyte colony-stimulating factor, Colony-stimulating factor 3, CSF-3, MGI-1G, Pluripoietin
  • Research fields: Neurobiology;Stem cell biology
  • Tool sub type: Cytokine
  • Sequence: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
  • Cellular tissue localisation: Hematopoietic Stem and Progenitor cells, Neurons, Cancer cells, Mesoderm, PSC-Derived
  • Source: Produced in Escherichia coli
  • Description: Granulocyte colony-stimulating factor (G-CSF) is a member of the CSF family of glycoproteins that regulate hematopoietic cell proliferation, differentiation, and function. It is a key cytokine involved in the production of neutrophils and the stimulation of granulocyte colony formation from hematopoietic progenitor cells. G-CSF causes a range of effects including a transient reduction of SDF-1 expression, the activation of metalloproteases that cleave VCAM-1, and the release of norepinephrine from the sympathetic nervous system, leading to the release or mobilization of hematopoietic stem cells from the bone marrow into the periphery. The G-CSF receptor is expressed on a variety of hematopoietic cells, including myeloid-committed progenitor cells, neutrophils, granulocytes, and monocytes. In addition to hematopoietic cells, G-CSF is also expressed in cardiomyocytes, neuronal cells, mesothelial cells, and endothelial cells. Binding of G-CSF to its receptor leads to activation of the JAK/STAT, MAPK, PI3K, and AKT signal transduction pathways.
  • Molecular weight: 18.8 kDa
  • Expression system: Recombinant
  • Uniprot id: P09919-2
  • Additional notes: Met at the N-terminus

Handling

  • Storage conditions: 4° C
  • Shipping conditions: Dry Ice

Application Details

  • Application notes: Molecular Weight: 18.8 kDa UniProt number P09919-2 (Met at the N-terminus)