ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the a3?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.
| Inventor | Institute |
|---|---|
| Arnoud Sonnenberg | Netherlands Cancer Institute |
| Cat. #: | 154739 |
|---|---|
| Tool sub type: | Primary antibody |
| Unit size: | 100 ug |
| Research Fields: | Cell biology;Cell signaling and signal transduction |
| Application: | IHC ; WB |
| Target: | Integrin a3A |
| Reactivity: | Dog ; Human |
| Host: | Mouse |
| Class: | Monoclonal |
| Alternate name: | ITGA3; Antigen CD49C |
|---|---|
| Product description: | ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the ÄÂ?3ÄÂ?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin. |
| Conjugation: | Unconjugated |
| Isotype: | IgG2a |
| Immunogen: | A mouse was immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. |
| Myeloma used: | Sp2/0-Ag14 |
| Target background: | ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the a3?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin. |
|---|
| Format: | Liquid |
|---|---|
| Concentration: | 0.9-1.1 mg/ml |
| Storage buffer: | PBS with 0.02% azide |
| Storage conditions: | -15° C to -25° C |
| Shipping conditions: | Dry ice |
| References: |
de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516. Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006. |
|---|
| Cat. # | Tool Name | |||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 151022 | Anti-IL12 [1-1A4] |
Key Info
Anti-IL12 [1-1A4]
|
View Tool | |||||||||||||||||||
| 151017 | Anti-MBP [R29.6] |
Key Info
Anti-MBP [R29.6]
|
View Tool | |||||||||||||||||||
| 151026 | Anti-FCGR1 [10.1] mAb |
Key Info
Anti-FCGR1 [10.1] mAb
|
View Tool | |||||||||||||||||||
| 151035 | Anti-CD8 [14] mAb |
Key Info
Anti-CD8 [14] mAb
|
View Tool | |||||||||||||||||||
| 151018 | Anti-Mos [R38.1] |
Key Info
Anti-Mos [R38.1]
|
View Tool | |||||||||||||||||||
Please note we may take up to three days to respond to your enquiry.
CancerTools.org uses the contact information provided to respond to you about our research tools and service. For more information please review our privacy policy.