#152986

37AA – p53-derived apoptotic Peptide

Cat. #152986

37AA – p53-derived apoptotic Peptide

Cat. #: 152986

Availability: Please enquire for quantities and pricing

Target: P53

This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.

Contributor

Inventor: Kevin Ryan

Institute: Cancer Research UK, Glasgow: The Beatson Institute

Tool Details
Handling
Target Details
Application Details
References

Tool Details

*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)

  • Tool name: 37AA – p53-derived apoptotic Peptide
  • Alternate name: pp
  • Research fields: Apoptosis and autophagy;Cancer
  • Sequence: MTAKSVTCTYSPALNKMFCQLAKTCPEVVRRCPHHER
  • Cellular tissue localisation: Nucleus
  • Target: P53
  • Description: The transcription factor p53 reacts to diverse cellular stresses regulating target genes that induce senescence, apoptosis, DNA repair, cell cycle arrest or changes in metabolism. p53 is also capable of inducing apoptosis through non-transcriptional cytoplasmic processes. Ubiquitin ligase MDM2 ensures p53 remains inactive in unstressed cells inhibiting p53 transcriptional activity and promoting its degradation via ubiquitination. Modulation of p53 occurs through a variety of post-translational modifications, like phosphorylation and acetylation. The loss of p53 activity is routinely lost in human cancer. This is either due to mutation of the p53 gene or through a loss of cell signalling either, upstream or downstream of p53. The p53-derived peptide: 37AA induces cell death without the need to directly activate p53 target genes. The 37AA peptide also induces cell death in multiple tumour cell types but not in normal cells. 37AA binds directly to iASPP, disrupting the interaction between iASPP and p73 causing derepression of endogenous p73. This subsequently causes activation of p73 target genes and cell death. The peptide also functions in vivo, as administration of a transgene expressing this peptide resulted in tumour regression in a manner dependent on p73.
  • Additional notes: Transformation-related protein 53; TRP53

Handling

  • Shipping conditions: Dry Ice

Target Details

  • Target: P53

Application Details

  • Application notes: Transformation-related protein 53; TRP53

References

  • Bell et al. 2007. J Clin Invest. 117(4):1008-18. PMID: 17347683.
  • A p53-derived apoptotic peptide derepresses p73 to cause tumor regression in vivo.

Tool enquiry

Please ensure you use your organisation email address rather than personal where possible, as this helps us locate your organisation in our system faster.

Please note we may take up to three days to respond to your enquiry.

CancerTools.org uses the contact information provided to respond to you about our research tools and service. For more information please review our privacy policy.