![Anti-Activin C [BetaC1]](https://cancertools.org/wp-content/uploads/b3afd6b8-3bd8-4750-8407-2d5c27b2d0df.png)
Cat. #153637
Anti-Activin C [BetaC1]
Cat. #: 153637
Sub-type: Primary antibody
Unit size: 100 ug
Availability: 10-12 weeks
Target: Activin C
Class: Monoclonal
Application: IHC ; WB
Reactivity: Human
Host: Mouse
£300.00
This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.
Contributor
Institute: BioServ UK Ltd
Tool Details
*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)
- Name: Anti-Activin C [BetaC1]
- Alternate name: Activin beta-C chain, Inhibin beta C chain
- Research fields: Cancer;Immunology
- Clone: BetaC1
- Tool sub type: Primary antibody
- Class: Monoclonal
- Conjugation: Unconjugated
- Strain: Balb/c
- Reactivity: Human
- Host: Mouse
- Application: IHC ; WB
- Description: Activin is part of the TGF-beta superfamily, known to regulate growth and differentiation of cells. The ÄÂ?-C subunit of Activin is expressed in a range of tissues having growth promoting and inhibitory properties. ÄÂ?-C Clone 1 recognizes the ÄÂ?-C subunit of Activin and is a useful stain to detect expression of the protein in hepatocyte cells.
- Immunogen: Synthetic peptide sequence VPTARRPLSLLYYDRDSNIKVTDIPMVVEAC which recognizes amino acids 82-113 of human Activin ? -C subunit
- Isotype: IgG1
- Myeloma used: Sp2/0-Ag14
- Recommended controls: Liver
Target Details
- Target: Activin C
- Tissue cell line specificity: Liver
- Target background: Activin is part of the TGF-beta superfamily, known to regulate growth and differentiation of cells. The ?-C subunit of Activin is expressed in a range of tissues having growth promoting and inhibitory properties. ?-C Clone 1 recognizes the ?-C subunit of Activin and is a useful stain to detect expression of the protein in hepatocyte cells.
Applications
- Application: IHC ; WB
Handling
- Format: Liquid
- Unit size: 100 ug
- Shipping conditions: Shipping at 4° C
References
- Gold et al. 2005. J Mol Endocrinol. 34(2):505-15. PMID: 15821113.
- betaA- and betaC-activin, follistatin, activin receptor mRNA and betaC-activin peptide expression during rat liver regeneration.
- Mellor et al. 2003. Endocrinology. 144(10):4410-9. PMID: 12960042.
- Activin betaC-subunit heterodimers provide a new mechanism of regulating activin levels in the prostate.
- Mellor et al. 2000. J Clin Endocrinol Metab. 85(12):4851-8. PMID: 11134153.
- Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.
