Antibody to DAX-1 (NR0B1), an unusual orphan member of the nuclear hormone receptor family. Duplications in Xp21, containing the DAX-1 gene, cause phenotypic sex reversal in XY individuals (DSS), while DAX-1 gene mutations are responsible for adrenal hypoplasia congenita (AHC), invariably associated with hypogonadotropic hypogonadism (HHG). DAX-1 functions as a negative regulator of steroid hormone […]
| Institute |
|---|
| Institut de Génétique et de Biologie Moléculaire et Cellulaire (IGBMC) |
| Cat. #: | 162400 |
|---|---|
| Research Fields: | Developmental biology |
| Application: | ELISA, WB, IHC, ICC, immunoprecipitation |
| Target: | DAX-1 (NROB1) |
| Reactivity: | Human, mouse, rat |
| Clone: | 1DA-2F4 |
| Host: | Mouse |
| Class: | Monoclonal |
| Primary citation: | Zanaria et al. (1994), Nature 372: 635-641. PMID: 7990953 |
| Product description: | Antibody to DAX-1 (NR0B1), an unusual orphan member of the nuclear hormone receptor family. Duplications in Xp21, containing the DAX-1 gene, cause phenotypic sex reversal in XY individuals (DSS), while DAX-1 gene mutations are responsible for adrenal hypoplasia congenita (AHC), invariably associated with hypogonadotropic hypogonadism (HHG). DAX-1 functions as a negative regulator of steroid hormone production by repressing the expression of multiple genes involved in the steroidogenic pathway. |
|---|---|
| Additional notes: | Avoid repeat freezing and thawing cycles. Does not contain any preservative. |
| Conjugation: | Unconjugated |
| Isotype: | IgG1, k |
| Immunogen: | Synthetic peptide corresponding to aa 135-166 of human DAX-1: (C)GEDHPRQGSILYSLLTSSKQTHVAPAAPEAR |
| Target background: | DAX-1 (NR0B1) is an unusual orphan member of the nuclear hormone receptor family. Duplications in Xp21, containing the DAX-1 gene, cause phenotypic sex reversal in XY individuals (DSS), while DAX-1 gene mutations are responsible for adrenal hypoplasia congenita (AHC), invariably associated with hypogonadotropic hypogonadism (HHG). DAX-1 functions as a negative regulator of steroid hormone production by repressing the expression of multiple genes involved in the steroidogenic pathway. |
|---|
| Storage conditions: | -20°C (up to 3 years) |
|---|
| References: |
Tamai, KT, et al. (1996). Mol Endocrinol. 10: 1561-1569, PMID: 8961266 Zanaria et al. (1994), Nature 372: 635-641, PMID: 7990953 |
|---|
| Cat. # | Tool Name | |||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 151030 | Anti-Progesterone [11P14] |
Key Info
Anti-Progesterone [11P14]
|
View Tool | |||||||||||||||||||
| 151029 | Anti-HSVICP8 [11E2] |
Key Info
Anti-HSVICP8 [11E2]
|
View Tool | |||||||||||||||||||
| 151031 | Anti-RuvA [RuvA 12C6] |
Key Info
Anti-RuvA [RuvA 12C6]
|
View Tool | |||||||||||||||||||
| 151034 | Anti-HSVUL42 [13D11] |
Key Info
Anti-HSVUL42 [13D11]
|
View Tool | |||||||||||||||||||
| 151038 | Anti-Cytochrome P450 4A2, 4A3 [Clo4] |
Key Info
Anti-Cytochrome P450 4A2, 4A3 [Clo4]
|
View Tool | |||||||||||||||||||
Please note we may take up to three days to respond to your enquiry.
CancerTools.org uses the contact information provided to respond to you about our research tools and service. For more information please review our privacy policy.