Anti-Activin C [BetaC1]

?-C Clone 1 recognizes the ?-C subunit of Activin and is a useful stain to detect expression of the protein in hepatocyte cells.

Contributors

Institute
BioServ UK Ltd
SKU: 153637
Product description: Activin is part of the TGF-beta superfamily, known to regulate growth and differentiation of cells. The Î?-C subunit of Activin is expressed in a range of tissues having growth promoting and inhibitory properties. Î?-C Clone 1 recognizes the Î?-C subunit of Activin and is a useful stain to detect expression of the protein in hepatocyte cells.
Alternate name: Activin beta-C chain, Inhibin beta C chain
Conjugation: Unconjugated
Isotype: IgG1
Immunogen: Synthetic peptide sequence VPTARRPLSLLYYDRDSNIKVTDIPMVVEAC which recognizes amino acids 82-113 of human Activin ? -C subunit
Myeloma used: Sp2/0-Ag14
Cat. #: 153637
Tool sub type: Primary antibody
Unit size: 100 ug
Research Fields: Cancer; Immunology
Application: IHC ; WB
Target: Activin C
Reactivity: Human
Clone: BetaC1
Host: Mouse
Class: Monoclonal
Target background: Activin is part of the TGF-beta superfamily, known to regulate growth and differentiation of cells. The ?-C subunit of Activin is expressed in a range of tissues having growth promoting and inhibitory properties. ?-C Clone 1 recognizes the ?-C subunit of Activin and is a useful stain to detect expression of the protein in hepatocyte cells.
Format: Liquid
Shipping conditions: Dry ice
References:

Gold et al. 2005. J Mol Endocrinol. 34(2):505-15. PMID: 15821113.

betaA- and betaC-activin, follistatin, activin receptor mRNA and betaC-activin peptide expression during rat liver regeneration.

Mellor et al. 2003. Endocrinology. 144(10):4410-9. PMID: 12960042.

Activin betaC-subunit heterodimers provide a new mechanism of regulating activin levels in the prostate.

Mellor et al. 2000. J Clin Endocrinol Metab. 85(12):4851-8. PMID: 11134153.

Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.

Images

View Gallery

Tool enquiry

Please ensure you use your organisation email address rather than personal where possible, as this helps us locate your organisation in our system faster.

Please note we may take up to three days to respond to your enquiry.

CancerTools.org uses the contact information provided to respond to you about our research tools and service. For more information please review our privacy policy.