Cat. #161713
Recombinant holo-Acyl carrier protein (holo-AcpM) from Mycobacterium tuberculosis (tagged)
Cat. #: 161713
Sub-type: Carrier protein
This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.
Contributor
Inventor: Dr. Alistair K. Brown
Institute: The University of Newcastle Upon Tyne
Primary Citation: Kremer et al. 2011. Journal of Biological Chemistry. 276(30):27967-74. PMID: 11373294
Tool Details
*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)
- Tool name: Recombinant holo-Acyl carrier protein (holo-AcpM) from Mycobacterium tuberculosis (tagged)
- Tool sub type: Carrier protein
- Sequence: MGSSHHHHHHSSGLVPRGSHMPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK
- Source: Mycobacterium tuberculosis (tagged)
- Description: Activated recombinant AcpM from Mycobacterium tuberculosis (cleavable tag) expressed in an E.coli BL21(DE3) derivative. N-terminal His6-tagged thrombin cleavable (underlined) AcpM.
- Molecular weight: Holo-AcpP Mw (with His6-tag): 15027.28
Handling
- Purity: Minimum purity: 90% by LC-MS and SDS-PAGE.
References
- Kremer et al. 2011. Journal of Biological Chemistry. 276(30):27967-74. PMID: 11373295