#161713

Recombinant holo-Acyl carrier protein (holo-AcpM) from Mycobacterium tuberculosis (tagged)

Cat. #161713

Recombinant holo-Acyl carrier protein (holo-AcpM) from Mycobacterium tuberculosis (tagged)

Cat. #: 161713

Sub-type: Carrier protein

This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.

Contributor

Inventor: Dr. Alistair K. Brown

Institute: The University of Newcastle Upon Tyne

Primary Citation: Kremer et al. 2011. Journal of Biological Chemistry. 276(30):27967-74. PMID: 11373294

Tool Details
Handling
References

Tool Details

*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)

  • Tool name: Recombinant holo-Acyl carrier protein (holo-AcpM) from Mycobacterium tuberculosis (tagged)
  • Tool sub type: Carrier protein
  • Sequence: MGSSHHHHHHSSGLVPRGSHMPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK
  • Source: Mycobacterium tuberculosis (tagged)
  • Description: Activated recombinant AcpM from Mycobacterium tuberculosis (cleavable tag) expressed in an E.coli BL21(DE3) derivative. N-terminal His6-tagged thrombin cleavable (underlined) AcpM.
  • Molecular weight: Holo-AcpP Mw (with His6-tag): 15027.28

Handling

  • Purity: Minimum purity: 90% by LC-MS and SDS-PAGE.

References

  • Kremer et al. 2011. Journal of Biological Chemistry. 276(30):27967-74. PMID: 11373295