
Cat. #162400
Monoclonal antibody anti-DAX-1 (DAX-2F4)
Cat. #: 162400
Target: DAX-1 (NROB1)
Class: Monoclonal
Application: ELISA, WB, IHC, ICC, immunoprecipitation
Reactivity: Human, mouse, rat
Host: Mouse
£300.00
This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.
Contributor
Institute: Institut de Génétique et de Biologie Moléculaire et Cellulaire (IGBMC)
Primary Citation: Zanaria et al. (1994), Nature 372: 635-641. PMID: 7990953
Tool Details
*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)
- Name: Monoclonal antibody anti-DAX-1 (DAX-2F4)
- Research fields: Developmental biology
- Clone: 1DA-2F4
- Class: Monoclonal
- Conjugation: Unconjugated
- Reactivity: Human, mouse, rat
- Host: Mouse
- Application: ELISA, WB, IHC, ICC, immunoprecipitation
- Description: Antibody to DAX-1 (NR0B1), an unusual orphan member of the nuclear hormone receptor family. Duplications in Xp21, containing the DAX-1 gene, cause phenotypic sex reversal in XY individuals (DSS), while DAX-1 gene mutations are responsible for adrenal hypoplasia congenita (AHC), invariably associated with hypogonadotropic hypogonadism (HHG). DAX-1 functions as a negative regulator of steroid hormone production by repressing the expression of multiple genes involved in the steroidogenic pathway.
- Immunogen: Synthetic peptide corresponding to aa 135-166 of human DAX-1: (C)GEDHPRQGSILYSLLTSSKQTHVAPAAPEAR
- Isotype: IgG1, k
- Additional notes: Avoid repeat freezing and thawing cycles. Does not contain any preservative.
Target Details
- Target: DAX-1 (NROB1)
- Target background: DAX-1 (NR0B1) is an unusual orphan member of the nuclear hormone receptor family. Duplications in Xp21, containing the DAX-1 gene, cause phenotypic sex reversal in XY individuals (DSS), while DAX-1 gene mutations are responsible for adrenal hypoplasia congenita (AHC), invariably associated with hypogonadotropic hypogonadism (HHG). DAX-1 functions as a negative regulator of steroid hormone production by repressing the expression of multiple genes involved in the steroidogenic pathway.
Applications
- Application: ELISA, WB, IHC, ICC, immunoprecipitation
- Application notes: Available as Crude Ascites Fluid. Recommended dilutions: 1/500-1/5000.
Handling
- Storage conditions: -20°C (up to 3 years)
References
- Tamai, KT, et al. (1996). Mol Endocrinol. 10: 1561-1569, PMID: 8961266
- Zanaria et al. (1994), Nature 372: 635-641, PMID: 7990953

![Anti-CAR Whitlow Linker [1C3C3]](https://cancertools.org/wp-content/uploads/Figure-6-Kimble-et-al.-J-Immunother-Cancer-2025-300x322.jpg 300w, https://cancertools.org/wp-content/uploads/Figure-6-Kimble-et-al.-J-Immunother-Cancer-2025-280x300.jpg 280w, https://cancertools.org/wp-content/uploads/Figure-6-Kimble-et-al.-J-Immunother-Cancer-2025-954x1024.jpg 954w, https://cancertools.org/wp-content/uploads/Figure-6-Kimble-et-al.-J-Immunother-Cancer-2025-768x824.jpg 768w, https://cancertools.org/wp-content/uploads/Figure-6-Kimble-et-al.-J-Immunother-Cancer-2025.jpg 1193w)
