#154739

Anti-Integrin a-3A [158A3]

Cat. #154739

Anti-Integrin a-3A [158A3]

Cat. #: 154739

Sub-type: Primary antibody

Unit size: 100 ug

Availability: 10-12 weeks

Target: Integrin a3A

Class: Monoclonal

Application: IHC ; WB

Reactivity: Dog ; Human

Host: Mouse

£300.00

This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.

Contributor

Inventor: Arnoud Sonnenberg

Institute: Netherlands Cancer Institute

Tool Details
Target Details
Applications
Handling
References

Tool Details

*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)

  • Name: Anti-Integrin a-3A [158A3]
  • Alternate name: ITGA3; Antigen CD49C
  • Research fields: Cell biology;Cell signaling and signal transduction
  • Tool sub type: Primary antibody
  • Class: Monoclonal
  • Conjugation: Unconjugated
  • Strain: Balb/c
  • Reactivity: Dog ; Human
  • Host: Mouse
  • Application: IHC ; WB
  • Description: ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the Î?3Î?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.
  • Immunogen: A mouse was immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
  • Isotype: IgG2a
  • Myeloma used: Sp2/0-Ag14

Target Details

  • Target: Integrin a3A
  • Target background: ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the a3?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.

Applications

  • Application: IHC ; WB

Handling

  • Format: Liquid
  • Concentration: 0.9-1.1 mg/ml
  • Unit size: 100 ug
  • Storage buffer: PBS with 0.02% azide
  • Storage conditions: -15° C to -25° C
  • Shipping conditions: Dry ice

References

  • de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.
  • Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.

Tool enquiry

Please ensure you use your organisation email address rather than personal where possible, as this helps us locate your organisation in our system faster.

Please note we may take up to three days to respond to your enquiry.

CancerTools.org uses the contact information provided to respond to you about our research tools and service. For more information please review our privacy policy.