#154739

Anti-Integrin a-3A [158A3]

Cat. #154739

Anti-Integrin a-3A [158A3]

Cat. #: 154739

Sub-type: Primary antibody

Unit size: 100 ug

Availability: 10-12 weeks

Target: Integrin a3A

Class: Monoclonal

Application: IHC ; WB

Reactivity: Dog ; Human

Host: Mouse

£300.00

This fee is applicable only for non-profit organisations. If you are a for-profit organisation or a researcher working on commercially-sponsored academic research, you will need to contact our licensing team for a commercial use license.

Contributor

Inventor: Arnoud Sonnenberg

Institute: Netherlands Cancer Institute

Tool Details
Target Details
Applications
Handling
References

Tool Details

*FOR RESEARCH USE ONLY (for other uses, please contact the licensing team)

  • Name: Anti-Integrin a-3A [158A3]
  • Alternate name: ITGA3; Antigen CD49C
  • Research fields: Cell biology;Cell signaling and signal transduction
  • Tool sub type: Primary antibody
  • Class: Monoclonal
  • Conjugation: Unconjugated
  • Strain: Balb/c
  • Reactivity: Dog ; Human
  • Host: Mouse
  • Application: IHC ; WB
  • Description: ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the Î?3Î?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.
  • Immunogen: A mouse was immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
  • Isotype: IgG2a
  • Myeloma used: Sp2/0-Ag14

Target Details

  • Target: Integrin a3A
  • Target background: ITGA3 is an integrin alpha subunit. Together with beta-1 subunit, it makes up half of the a3?1 integrin duplex that plays a role in neural migration and corticogenesis, acted upon by such factors as netrin-1 and reelin.

Applications

  • Application: IHC ; WB

Handling

  • Format: Liquid
  • Concentration: 0.9-1.1 mg/ml
  • Unit size: 100 ug
  • Storage buffer: PBS with 0.02% azide
  • Storage conditions: -15° C to -25° C
  • Shipping conditions: Dry ice

References

  • de Melker et al. 1997. Lab Invest. 76(4):547-63. PMID: 9111516.
  • Delwel et al. 1994. Mol Biol Cell. 5(2):203-15. PMID: 8019006.